ADAM12 anticorps

N° du produit ABIN634632

Détail du produit anti-ADAM12 anticorps

Antigène: ADAM12 (ADAM Metallopeptidase Domain 12 (ADAM12))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADAM12 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ADAM12 antibody was raised using a synthetic peptide corresponding to a region with amino acids VELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADAM12 Blocking Peptide, catalog no. 33R-9503, is also available for use as a blocking control in assays to test for specificity of this ADAM12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADAM12

Antigène: ADAM12 (ADAM Metallopeptidase Domain 12 (ADAM12))

Autre désignation: ADAM12 (ADAM12 Produits)

Synonymes: anticorps ADAM12, anticorps adam12, anticorps Mltna, anticorps mKIAA4001, anticorps MCMP, anticorps MCMPMltna, anticorps MLTN, anticorps MLTNA, anticorps ADAM metallopeptidase domain 12, anticorps a disintegrin and metallopeptidase domain 12 (meltrin alpha), anticorps ADAM12, anticorps adam12, anticorps Adam12

Sujet: ADAM12 is a member of the ADAM (a disintegrin and metalloprotease) protein family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis.

Poids moléculaire: 58 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway