ADAMDEC1 anticorps (Middle Region)
-
- Antigène Voir toutes ADAMDEC1 Anticorps
- ADAMDEC1 (ADAM-Like, Decysin 1 (ADAMDEC1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ADAMDEC1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ADAMDEC1 antibody was raised against the middle region of ADAMDEC1
- Purification
- Affinity purified
- Immunogène
- ADAMDEC1 antibody was raised using the middle region of ADAMDEC1 corresponding to a region with amino acids GMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCL
- Top Product
- Discover our top product ADAMDEC1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ADAMDEC1 Blocking Peptide, catalog no. 33R-3436, is also available for use as a blocking control in assays to test for specificity of this ADAMDEC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAMDEC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ADAMDEC1 (ADAM-Like, Decysin 1 (ADAMDEC1))
- Autre désignation
- ADAMDEC1 (ADAMDEC1 Produits)
- Synonymes
- anticorps ADAMDEC1, anticorps 2210414L24Rik, anticorps AI574231, anticorps Dcsn, anticorps M12.219, anticorps ADAM-like, decysin 1, anticorps ADAM like decysin 1, anticorps Adamdec1, anticorps ADAMDEC1
- Sujet
- This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation.
- Poids moléculaire
- 53 kDa (MW of target protein)
-