NID2 anticorps

N° du produit ABIN634637

Détail du produit anti-NID2 anticorps

Antigène: NID2 (Nidogen 2 (NID2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NID2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: NID2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDLGHFIPLQCHGKSDFCWCVDKDGREVQGTRSQPGTTPACIPTVAPPMV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NID2 Blocking Peptide, catalog no. 33R-1881, is also available for use as a blocking control in assays to test for specificity of this NID2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NID2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NID2

Antigène: NID2 (Nidogen 2 (NID2))

Autre désignation: NID2 (NID2 Produits)

Synonymes: anticorps AW547149, anticorps Ly111, anticorps NID-2, anticorps entactin-2, anticorps nidogen-2, anticorps nidogen 2, anticorps Nid2, anticorps NID2

Sujet: Basement membranes, which are composed of type IV collagens, laminins, perlecan, and nidogen, are thin pericellular protein matrices that control a large number of cellular activities, including adhesion, migration, differentiation, gene expression, and apoptosis.

Poids moléculaire: 148 kDa (MW of target protein)