HAPLN1 anticorps (N-Term)

N° du produit ABIN634638

Cet anticorps anti-HAPLN1 est un anticorps Lapin Polyclonal détectant HAPLN1 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour HAPLN1 anticorps (N-Term) (ABIN634638)

Antigène: HAPLN1 (Hyaluronan and Proteoglycan Link Protein 1 (HAPLN1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HAPLN1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HAPLN1 anticorps

Épitope: N-Term

Specificité: HAPLN1 antibody was raised against the N terminal of HAPLN1

Purification: Affinity purified

Immunogène: HAPLN1 antibody was raised using the N terminal of HAPLN1 corresponding to a region with amino acids ENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HAPLN1 Blocking Peptide, (ABIN937991), is also available for use as a blocking control in assays to test for specificity of this HAPLN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAPLN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HAPLN1

Antigène: HAPLN1 (Hyaluronan and Proteoglycan Link Protein 1 (HAPLN1))

Autre désignation: HAPLN1

Sujet: HAPLN1 stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix.

Poids moléculaire: 40 kDa (MW of target protein)