Periostin anticorps (Middle Region)

N° du produit ABIN634643

L’anticorps anti-Periostin Polyclonal Lapin est utilisé pour la détection de Periostin dans des échantillons de Humain et Souris. Il a été validé pour WB.

Aperçu rapide pour Periostin anticorps (Middle Region) (ABIN634643)

Antigène: Periostin (POSTN)

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Periostin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Periostin anticorps

Épitope: Middle Region

Specificité: POSTN antibody was raised against the middle region of POSTN

Purification: Affinity purified

Immunogène: POSTN antibody was raised using the middle region of POSTN corresponding to a region with amino acids VTKFIEGGDGHLFEDEEIKRLLQGDTPVRKLQANKKVQGSRRRLREGRSQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

POSTN Blocking Peptide, (ABIN5615476), is also available for use as a blocking control in assays to test for specificity of this POSTN antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POSTN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Periostin

Antigène: Periostin (POSTN)

Autre désignation: POSTN

Sujet: POSTN binds to heparin. It induces cell attachment and spreading and plays a role in cell adhesion. POSTN may play a role in extracellular matrix mineralization.

Poids moléculaire: 93 kDa (MW of target protein)