Osteomodulin anticorps (Middle Region)

N° du produit ABIN634647

Détail du produit anti-Osteomodulin anticorps

Antigène: Osteomodulin (OMD)

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Osteomodulin est non-conjugé

Application: Western Blotting (WB)

Specificité: Osteomodulin antibody was raised against the middle region of OMD

Purification: Affinity purified

Immunogène: Osteomodulin antibody was raised using the middle region of OMD corresponding to a region with amino acids LLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Osteomodulin Blocking Peptide, catalog no. 33R-5180, is also available for use as a blocking control in assays to test for specificity of this Osteomodulin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OMD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Osteomodulin

Antigène: Osteomodulin (OMD)

Autre désignation: Osteomodulin (OMD Produits)

Synonymes: anticorps si:ch211-103f16.5, anticorps OMD, anticorps OSAD, anticorps SLRR2C, anticorps osteomodulin, anticorps omd, anticorps OMD, anticorps Omd

Sujet: OMD may be implicated in biomineralization processes. Has a function in binding of osteoblasts via the alpha(V)beta(3)-integrin.

Poids moléculaire: 49 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process