Laminin beta 3 anticorps (Middle Region)

N° du produit ABIN634648

Détail du produit anti-Laminin beta 3 anticorps

Antigène: Laminin beta 3 (LAMB3) (Laminin, beta 3 (LAMB3))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Laminin beta 3 est non-conjugé

Application: Western Blotting (WB)

Specificité: Laminin Beta 3 antibody was raised against the middle region of LAMB3

Purification: Affinity purified

Immunogène: Laminin Beta 3 antibody was raised using the middle region of LAMB3 corresponding to a region with amino acids ERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Laminin Beta 3 Blocking Peptide, catalog no. 33R-2696, is also available for use as a blocking control in assays to test for specificity of this Laminin Beta 3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAMB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Laminin beta 3

Antigène: Laminin beta 3 (LAMB3) (Laminin, beta 3 (LAMB3))

Autre désignation: Laminin beta 3 (LAMB3 Produits)

Synonymes: anticorps LAMB3, anticorps lam5, anticorps lamnb1, anticorps BM600-125KDA, anticorps LAM5, anticorps LAMNB1, anticorps laminin subunit beta 3, anticorps laminin, beta 3, anticorps LAMB3, anticorps lamb3, anticorps Lamb3

Sujet: The product encoded by this gene is a laminin that belongs to a family of basement membrane proteins. This protein is a beta subunit laminin, which together with an alpha and a gamma subunit, forms laminin-5.

Poids moléculaire: 128 kDa (MW of target protein)

Pathways: Brown Fat Cell Differentiation