SPON2 anticorps (N-Term)

N° du produit ABIN634656

Cet anticorps anti-SPON2 est un anticorps Lapin Polyclonal détectant SPON2 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour SPON2 anticorps (N-Term) (ABIN634656)

Antigène: SPON2 (Spondin 2 (SPON2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SPON2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SPON2 anticorps

Épitope: N-Term

Specificité: SPON2 antibody was raised against the N terminal of SPON2

Purification: Affinity purified

Immunogène: SPON2 antibody was raised using the N terminal of SPON2 corresponding to a region with amino acids CSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SPON2 Blocking Peptide, (ABIN937189), is also available for use as a blocking control in assays to test for specificity of this SPON2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPON2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SPON2

Antigène: SPON2 (Spondin 2 (SPON2))

Autre désignation: SPON2

Sujet: SPON2 is a cell adhesion protein that promote adhesion and outgrowth of hippocampal embryonic neurons. Binds directly to bacteria and their components and functions as an opsonin for macrophage phagocytosis of bacteria. It is essential in the initiation of the innate immune response and represents a unique pattern-recognition molecule in the ECM for microbial pathogens.

Poids moléculaire: 36 kDa (MW of target protein)