SPON2 anticorps (N-Term)

N° du produit ABIN634656

Détail du produit anti-SPON2 anticorps

Antigène: SPON2 (Spondin 2 (SPON2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SPON2 est non-conjugé

Application: Western Blotting (WB)

Specificité: SPON2 antibody was raised against the N terminal of SPON2

Purification: Affinity purified

Immunogène: SPON2 antibody was raised using the N terminal of SPON2 corresponding to a region with amino acids CSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SPON2 Blocking Peptide, catalog no. 33R-1803, is also available for use as a blocking control in assays to test for specificity of this SPON2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPON2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SPON2

Antigène: SPON2 (Spondin 2 (SPON2))

Autre désignation: SPON2 (SPON2 Produits)

Synonymes: anticorps DIL-1, anticorps DIL1, anticorps M-SPONDIN, anticorps MINDIN, anticorps 2310045I24Rik, anticorps AI504350, anticorps M-spondin, anticorps Mindin, anticorps Mspondin, anticorps etID309958.14, anticorps mindin2, anticorps zgc:100756, anticorps mindin1, anticorps spondin 2, anticorps spondin 2, extracellular matrix protein, anticorps spondin 2, extracellular matrix protein S homeolog, anticorps spondin 2b, extracellular matrix protein, anticorps spondin 2a, extracellular matrix protein, anticorps SPON2, anticorps Spon2, anticorps spon2.S, anticorps spon2b, anticorps spon2a

Sujet: SPON2 is a cell adhesion protein that promote adhesion and outgrowth of hippocampal embryonic neurons. Binds directly to bacteria and their components and functions as an opsonin for macrophage phagocytosis of bacteria. It is essential in the initiation of the innate immune response and represents a unique pattern-recognition molecule in the ECM for microbial pathogens.

Poids moléculaire: 36 kDa (MW of target protein)