AZGP1 anticorps (N-Term)

N° du produit ABIN634659

Cet anticorps anti-AZGP1 Polyclonal Lapin (ABIN634659) détecte spécifiquement AZGP1 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour AZGP1 anticorps (N-Term) (ABIN634659)

Antigène: AZGP1 (alpha-2-Glycoprotein 1, Zinc-Binding (AZGP1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AZGP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-AZGP1 anticorps

Épitope: N-Term

Specificité: AZGP1 antibody was raised against the N terminal of AZGP1

Purification: Affinity purified

Immunogène: AZGP1 antibody was raised using the N terminal of AZGP1 corresponding to a region with amino acids KVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AZGP1 Blocking Peptide, (ABIN940086), is also available for use as a blocking control in assays to test for specificity of this AZGP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AZGP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AZGP1

Antigène: AZGP1 (alpha-2-Glycoprotein 1, Zinc-Binding (AZGP1))

Autre désignation: AZGP1

Sujet: Stimulates lipid degradation in adipocytes and causes the extensive fat losses associated with some advanced cancers. AZGP1 may bind polyunsaturated fatty acids.

Poids moléculaire: 33 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process