Claudin 23 anticorps (C-Term)

N° du produit ABIN634675

Détail du produit anti-Claudin 23 anticorps

Antigène: Claudin 23 (CLDN23)

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Claudin 23 est non-conjugé

Application: Western Blotting (WB)

Specificité: Claudin 23 antibody was raised against the C terminal of CLDN23

Purification: Affinity purified

Immunogène: Claudin 23 antibody was raised using the C terminal of CLDN23 corresponding to a region with amino acids IKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWE

Information d'application

Indications d'application: WB: 0.2-0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Claudin 23 Blocking Peptide, catalog no. 33R-4034, is also available for use as a blocking control in assays to test for specificity of this Claudin 23 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN23 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Claudin 23

Antigène: Claudin 23 (CLDN23)

Autre désignation: Claudin 23 (CLDN23 Produits)

Synonymes: anticorps CLDN23, anticorps CLDNL, anticorps hCG1646163, anticorps 2310014B08Rik, anticorps claudin 23, anticorps si:ch211-95j8.2, anticorps CLDN23, anticorps si:ch211-95j8.2, anticorps Cldn23

Sujet: CLDN23 is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C. It is a candidate tumor suppressor gene implicated in intestinal-type gastric cancer.

Poids moléculaire: 17 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C