Desmoglein 2 anticorps (N-Term)

N° du produit ABIN634678

Cet anticorps Lapin Polyclonal détecte spécifiquement Desmoglein 2 dans WB. Il présente une réactivité envers Humain, Rat et Souris.

Aperçu rapide pour Desmoglein 2 anticorps (N-Term) (ABIN634678)

Antigène: Desmoglein 2 (DSG2)

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Desmoglein 2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Desmoglein 2 anticorps

Épitope: N-Term

Specificité: Desmoglein 2 antibody was raised against the N terminal of DSG2

Purification: Affinity purified

Immunogène: Desmoglein 2 antibody was raised using the N terminal of DSG2 corresponding to a region with amino acids KIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Desmoglein 2 Blocking Peptide, (ABIN939816), is also available for use as a blocking control in assays to test for specificity of this Desmoglein 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DSG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Desmoglein 2

Antigène: Desmoglein 2 (DSG2)

Autre désignation: Desmoglein 2

Sujet: Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. DSG2 is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. This second family member is expressed in colon, colon carcinoma, and other simple and stratified epithelial-derived cell lines.

Poids moléculaire: 114 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization