ROM1 anticorps (Middle Region)

N° du produit ABIN634680

Cet anticorps anti-ROM1 Polyclonal Lapin (ABIN634680) détecte spécifiquement ROM1 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour ROM1 anticorps (Middle Region) (ABIN634680)

Antigène: ROM1 (Retinal Outer Segment Membrane Protein 1 (ROM1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ROM1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ROM1 anticorps

Épitope: Middle Region

Specificité: ROM1 antibody was raised against the middle region of ROM1

Purification: Affinity purified

Immunogène: ROM1 antibody was raised using the middle region of ROM1 corresponding to a region with amino acids NPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ROM1 Blocking Peptide, (ABIN5615915), is also available for use as a blocking control in assays to test for specificity of this ROM1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ROM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ROM1

Antigène: ROM1 (Retinal Outer Segment Membrane Protein 1 (ROM1))

Autre désignation: ROM1

Sujet: ROM1 is an integral membrane protein found in the photoreceptor disk rim of the eye. It can form homodimers or can heterodimerize with another photoreceptor, retinal degeneration slow (RDS). It is essential for disk morphogenesis, and may also function as an adhesion molecule involved in the stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. Certain defects in this gene have been associated with the degenerative eye disease retinitis pigmentosa.

Poids moléculaire: 37 kDa (MW of target protein)