ROM1 anticorps (Middle Region)

N° du produit ABIN634680

Détail du produit anti-ROM1 anticorps

Antigène: ROM1 (Retinal Outer Segment Membrane Protein 1 (ROM1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ROM1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ROM1 antibody was raised against the middle region of ROM1

Purification: Affinity purified

Immunogène: ROM1 antibody was raised using the middle region of ROM1 corresponding to a region with amino acids NPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ROM1 Blocking Peptide, catalog no. 33R-6819, is also available for use as a blocking control in assays to test for specificity of this ROM1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ROM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ROM1

Antigène: ROM1 (Retinal Outer Segment Membrane Protein 1 (ROM1))

Autre désignation: ROM1 (ROM1 Produits)

Synonymes: anticorps ROM, anticorps ROSP1, anticorps RP7, anticorps TSPAN23, anticorps ROM1, anticorps M101156, anticorps Rgsc1156, anticorps Rom-1, anticorps Rosp1, anticorps Tspan23, anticorps rds35, anticorps rom, anticorps rosp1, anticorps tspan23, anticorps Rds, anticorps zgc:56548, anticorps zgc:73336, anticorps zgc:77401, anticorps retinal outer segment membrane protein 1, anticorps rod outer segment membrane protein 1, anticorps retinal outer segment membrane protein 1 L homeolog, anticorps retinal outer segment membrane protein 1b, anticorps retinal outer segment membrane protein 1a, anticorps ROM1, anticorps Rom1, anticorps rom1.L, anticorps rom1b, anticorps rom1a

Sujet: ROM1 is an integral membrane protein found in the photoreceptor disk rim of the eye. It can form homodimers or can heterodimerize with another photoreceptor, retinal degeneration slow (RDS). It is essential for disk morphogenesis, and may also function as an adhesion molecule involved in the stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. Certain defects in this gene have been associated with the degenerative eye disease retinitis pigmentosa.

Poids moléculaire: 37 kDa (MW of target protein)