NINJ1 anticorps (N-Term)

N° du produit ABIN634689

Détail du produit anti-NINJ1 anticorps

Antigène: NINJ1 (Ninjurin 1 (NINJ1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NINJ1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Ninjurin 1 antibody was raised against the N terminal of NINJ1

Purification: Affinity purified

Immunogène: Ninjurin 1 antibody was raised using the N terminal of NINJ1 corresponding to a region with amino acids DSGTEEYELNGGLPPGTPGSPDASPARWGWRHGPINVNHYASKKSAAESM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Ninjurin 1 Blocking Peptide, catalog no. 33R-2165, is also available for use as a blocking control in assays to test for specificity of this Ninjurin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NINJ1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NINJ1

Antigène: NINJ1 (Ninjurin 1 (NINJ1))

Autre désignation: Ninjurin 1 (NINJ1 Produits)

Synonymes: anticorps nin1, anticorps MGC79511, anticorps ninjurin, anticorps NIN1, anticorps NINJURIN, anticorps AU024536, anticorps ninjurin 1, anticorps ninjurin 1 L homeolog, anticorps NINJ1, anticorps ninj1, anticorps ninj1.L, anticorps Ninj1

Sujet: NINJ1 is a homophilic cell adhesion molecule that promotes axonal growth. NINJ1 may play a role in nerve regeneration and in the formation and function of other tissues.

Poids moléculaire: 16 kDa (MW of target protein)