LSAMP anticorps (N-Term)

N° du produit ABIN634691

L’anticorps Lapin Polyclonal anti-LSAMP a été validé pour WB. Il convient pour détecter LSAMP dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour LSAMP anticorps (N-Term) (ABIN634691)

Antigène: LSAMP (Limbic System-Associated Membrane Protein (LSAMP))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LSAMP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LSAMP anticorps

Épitope: N-Term

Specificité: LSAMP antibody was raised against the N terminal of LSAMP

Purification: Affinity purified

Immunogène: LSAMP antibody was raised using the N terminal of LSAMP corresponding to a region with amino acids MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LSAMP Blocking Peptide, (ABIN5614593), is also available for use as a blocking control in assays to test for specificity of this LSAMP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSAMP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LSAMP

Antigène: LSAMP (Limbic System-Associated Membrane Protein (LSAMP))

Autre désignation: LSAMP

Sujet: LSAMP is a neuronal surface glycoprotein found in cortical and subcortical regions of the limbic system. During development of the limbic system, this protein is found on the surface of axonal membranes and growth cones, where it acts as a selective homophilic adhesion molecule, and guides the development of specific patterns of neuronal connections.

Poids moléculaire: 37 kDa (MW of target protein)