PCDHAC1 anticorps (N-Term)

N° du produit ABIN634693

Détail du produit anti-PCDHAC1 anticorps

Antigène: PCDHAC1 (Protocadherin alpha Subfamily C, 1 (PCDHAC1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCDHAC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PCDHAC1 antibody was raised against the N terminal of PCDHAC1

Purification: Affinity purified

Immunogène: PCDHAC1 antibody was raised using the N terminal of PCDHAC1 corresponding to a region with amino acids RVQALDPDEGSNGEVQYSLSNSTQAELRHRFHVHPKSGEVQVAASLGPPE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCDHAC1 Blocking Peptide, catalog no. 33R-8254, is also available for use as a blocking control in assays to test for specificity of this PCDHAC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHAC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCDHAC1

Antigène: PCDHAC1 (Protocadherin alpha Subfamily C, 1 (PCDHAC1))

Autre désignation: PCDHAC1 (PCDHAC1 Produits)

Synonymes: anticorps PCDH-ALPHA-C1, anticorps CNRc1, anticorps rCNRvc1, anticorps protocadherin alpha subfamily C, 1, anticorps PCDHAC1, anticorps Pcdhac1

Sujet: PCDHAC1 is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters.

Poids moléculaire: 87 kDa (MW of target protein)