PCDHAC2 anticorps (N-Term)

N° du produit ABIN634694

Détail du produit anti-PCDHAC2 anticorps

Antigène: PCDHAC2 (Protocadherin alpha Subfamily C, 2 (PCDHAC2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCDHAC2 est non-conjugé

Application: Western Blotting (WB)

Specificité: PCDHAC2 antibody was raised against the N terminal of PCDHAC2

Purification: Affinity purified

Immunogène: PCDHAC2 antibody was raised using the N terminal of PCDHAC2 corresponding to a region with amino acids SPAFDQSTYRVQLREDSPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCDHAC2 Blocking Peptide, catalog no. 33R-8663, is also available for use as a blocking control in assays to test for specificity of this PCDHAC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHAC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCDHAC2

Antigène: PCDHAC2 (Protocadherin alpha Subfamily C, 2 (PCDHAC2))

Autre désignation: PCDHAC2 (PCDHAC2 Produits)

Synonymes: anticorps PCDH-ALPHA-C2, anticorps CNRc2, anticorps rCNRvc2, anticorps CNRC02, anticorps PCHD, anticorps protocadherin alpha subfamily C, 2, anticorps PCDHAC2, anticorps Pcdhac2, anticorps pcdhac2

Sujet: PCDHAC2 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Poids moléculaire: 105 kDa (MW of target protein)