CSGALNACT1 anticorps (N-Term)

N° du produit ABIN634697

Détail du produit anti-CSGALNACT1 anticorps

Antigène: CSGALNACT1 (Chondroitin Sulfate N-Acetylgalactosaminyltransferase 1 (CSGALNACT1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CSGALNACT1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CSGALNACT1 antibody was raised against the N terminal Of Csgalnact1

Purification: Affinity purified

Immunogène: CSGALNACT1 antibody was raised using the N terminal Of Csgalnact1 corresponding to a region with amino acids KAEVNAGVKLATEYAAVPFDSFTLQKVYQLETGLTRHPEEKPVRKDKRDE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CSGALNACT1 Blocking Peptide, catalog no. 33R-4236, is also available for use as a blocking control in assays to test for specificity of this CSGALNACT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSGALNACT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CSGALNACT1

Antigène: CSGALNACT1 (Chondroitin Sulfate N-Acetylgalactosaminyltransferase 1 (CSGALNACT1))

Autre désignation: CSGALNACT1 (CSGALNACT1 Produits)

Synonymes: anticorps CSGalNAcT-1, anticorps ChGn, anticorps beta4GalNAcT, anticorps CHGN, anticorps 4732435N03Rik, anticorps Chgn, anticorps RGD1307618, anticorps chondroitin sulfate N-acetylgalactosaminyltransferase 1, anticorps CSGALNACT1, anticorps csgalnact1, anticorps Csgalnact1, anticorps LOC100517735

Sujet: CSGALNACT1 is a transfers 1,4-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of glucuronic acid (GlcUA). It is required for addition of the first GalNAc to the core tetrasaccharide linker and for elongation of chondroitin chains.

Poids moléculaire: 61 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process