DGCR2 anticorps (Middle Region)

N° du produit ABIN634699

Détail du produit anti-DGCR2 anticorps

Antigène: DGCR2 (DGS2) (DiGeorge Syndrome Chromosome Region-2 (DGS2))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DGCR2 est non-conjugé

Application: Western Blotting (WB)

Specificité: DGCR2 antibody was raised against the middle region of DGCR2

Purification: Affinity purified

Immunogène: DGCR2 antibody was raised using the middle region of DGCR2 corresponding to a region with amino acids AESCYEKSSFLCKRSQTCVDIKDNVVDEGFYFTPKGDDPCLSCTCHGGEP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DGCR2 Blocking Peptide, catalog no. 33R-1148, is also available for use as a blocking control in assays to test for specificity of this DGCR2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGCR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DGCR2

Antigène: DGCR2 (DGS2) (DiGeorge Syndrome Chromosome Region-2 (DGS2))

Autre désignation: DGCR2 (DGS2 Produits)

Synonymes: anticorps DGS-C, anticorps IDD, anticorps LAN, anticorps SEZ-12, anticorps CIDD, anticorps 9930034O06Rik, anticorps Dgsc, anticorps Idd, anticorps Lan, anticorps Sez12, anticorps mKIAA0163, anticorps zgc:91974, anticorps DiGeorge syndrome critical region gene 2, anticorps DiGeorge syndrome critical region gene 2 S homeolog, anticorps DGCR2, anticorps Dgcr2, anticorps dgcr2, anticorps dgcr2.S

Sujet: Deletions of the 22q11.2 have been associated with a wide range of developmental defects classified under the acronym CATCH 22. The DGCR2 is a novel putative adhesion receptor protein, which could play a role in neural crest cells migration, a process which has been proposed to be altered in DiGeorge syndrome.

Poids moléculaire: 61 kDa (MW of target protein)