CNTNAP4 anticorps (N-Term)

N° du produit ABIN634701

Cet anticorps anti-CNTNAP4 est un anticorps Lapin Polyclonal détectant CNTNAP4 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour CNTNAP4 anticorps (N-Term) (ABIN634701)

Antigène: CNTNAP4 (Contactin Associated Protein-Like 4 (CNTNAP4))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CNTNAP4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CNTNAP4 anticorps

Épitope: N-Term

Specificité: CNTNAP4 antibody was raised against the N terminal of CNTNAP4

Purification: Affinity purified

Immunogène: CNTNAP4 antibody was raised using the N terminal of CNTNAP4 corresponding to a region with amino acids KLPSTSTLVNLTLGSLLDDQHWHSVLIQRLGKQVNFTVDEHRHHFHARGE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CNTNAP4 Blocking Peptide, (ABIN939915), is also available for use as a blocking control in assays to test for specificity of this CNTNAP4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNTNAP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CNTNAP4

Antigène: CNTNAP4 (Contactin Associated Protein-Like 4 (CNTNAP4))

Autre désignation: CNTNAP4

Sujet: CNTNAP4 belongs to the neurexin family, members of which function in the vertebrate nervous system as cell adhesion molecules and receptors. This protein, like other neurexin proteins, contains epidermal growth factor repeats and laminin G domains. In addition, it includes an F5/8 type C domain, discoidin/neuropilin- and fibrinogen-like domains, and thrombospondin N-terminal-like domains.

Poids moléculaire: 145 kDa (MW of target protein)