CNTNAP4 anticorps (N-Term)
-
- Antigène Voir toutes CNTNAP4 Anticorps
- CNTNAP4 (Contactin Associated Protein-Like 4 (CNTNAP4))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CNTNAP4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CNTNAP4 antibody was raised against the N terminal of CNTNAP4
- Purification
- Affinity purified
- Immunogène
- CNTNAP4 antibody was raised using the N terminal of CNTNAP4 corresponding to a region with amino acids KLPSTSTLVNLTLGSLLDDQHWHSVLIQRLGKQVNFTVDEHRHHFHARGE
- Top Product
- Discover our top product CNTNAP4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CNTNAP4 Blocking Peptide, catalog no. 33R-4529, is also available for use as a blocking control in assays to test for specificity of this CNTNAP4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNTNAP4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CNTNAP4 (Contactin Associated Protein-Like 4 (CNTNAP4))
- Autre désignation
- CNTNAP4 (CNTNAP4 Produits)
- Sujet
- CNTNAP4 belongs to the neurexin family, members of which function in the vertebrate nervous system as cell adhesion molecules and receptors. This protein, like other neurexin proteins, contains epidermal growth factor repeats and laminin G domains. In addition, it includes an F5/8 type C domain, discoidin/neuropilin- and fibrinogen-like domains, and thrombospondin N-terminal-like domains.
- Poids moléculaire
- 145 kDa (MW of target protein)
-