ADAM2 anticorps

N° du produit ABIN634702

Cet anticorps Lapin Polyclonal détecte spécifiquement ADAM2 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour ADAM2 anticorps (ABIN634702)

Antigène: ADAM2 (ADAM Metallopeptidase Domain 2 (ADAM2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADAM2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ADAM2 anticorps

Purification: Affinity purified

Immunogène: ADAM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVIL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADAM2 Blocking Peptide, (ABIN5611934), is also available for use as a blocking control in assays to test for specificity of this ADAM2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADAM2

Antigène: ADAM2 (ADAM Metallopeptidase Domain 2 (ADAM2))

Autre désignation: ADAM2

Sujet: ADAM2 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM2 is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.

Poids moléculaire: 81 kDa (MW of target protein)