ADAM2 anticorps
-
- Antigène Voir toutes ADAM2 Anticorps
- ADAM2 (ADAM Metallopeptidase Domain 2 (ADAM2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ADAM2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ADAM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVIL
- Top Product
- Discover our top product ADAM2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ADAM2 Blocking Peptide, catalog no. 33R-7144, is also available for use as a blocking control in assays to test for specificity of this ADAM2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ADAM2 (ADAM Metallopeptidase Domain 2 (ADAM2))
- Autre désignation
- ADAM2 (ADAM2 Produits)
- Synonymes
- anticorps AI323749, anticorps Ftnb, anticorps Ph30-beta, anticorps CRYN1, anticorps CRYN2, anticorps CT15, anticorps FTNB, anticorps PH-30b, anticorps PH30, anticorps PH30-beta, anticorps PH-30, anticorps a disintegrin and metallopeptidase domain 2, anticorps ADAM metallopeptidase domain 2, anticorps Adam2, anticorps ADAM2
- Sujet
- ADAM2 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM2 is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.
- Poids moléculaire
- 81 kDa (MW of target protein)
-