Tetraspanin 2 anticorps (Middle Region)

N° du produit ABIN634704

Détail du produit anti-Tetraspanin 2 anticorps

Antigène: Tetraspanin 2 (TSPAN2)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Tetraspanin 2 est non-conjugé

Application: Western Blotting (WB)

Specificité: Tetraspanin 2 antibody was raised against the middle region of TSPAN2

Purification: Affinity purified

Immunogène: Tetraspanin 2 antibody was raised using the middle region of TSPAN2 corresponding to a region with amino acids FAFIGKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Tetraspanin 2 Blocking Peptide, catalog no. 33R-2840, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Tetraspanin 2

Antigène: Tetraspanin 2 (TSPAN2)

Autre désignation: Tetraspanin 2 (TSPAN2 Produits)

Synonymes: anticorps NET3, anticorps TSN2, anticorps TSPAN-2, anticorps 6330415F13Rik, anticorps B230119D02Rik, anticorps tspan-2, anticorps Tspan-2, anticorps tetraspanin 2, anticorps TSPAN2, anticorps tspan2, anticorps Tspan2

Sujet: TSPAN2 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.

Poids moléculaire: 24 kDa (MW of target protein)