MPZL2 anticorps (N-Term)
-
- Antigène Voir toutes MPZL2 Anticorps
- MPZL2 (Myelin Protein Zero-Like 2 (MPZL2))
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MPZL2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MPZL2 antibody was raised against the N terminal of MPZL2
- Purification
- Affinity purified
- Immunogène
- MPZL2 antibody was raised using the N terminal of MPZL2 corresponding to a region with amino acids LEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPF
- Top Product
- Discover our top product MPZL2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MPZL2 Blocking Peptide, catalog no. 33R-4881, is also available for use as a blocking control in assays to test for specificity of this MPZL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPZL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MPZL2 (Myelin Protein Zero-Like 2 (MPZL2))
- Autre désignation
- MPZL2 (MPZL2 Produits)
- Synonymes
- anticorps cb837, anticorps eva1, anticorps mpzl2, anticorps wu:fb07b02, anticorps EVA1, anticorps EVA, anticorps Eva, anticorps Eva1, anticorps myelin protein zero-like 2b, anticorps myelin protein zero like 2, anticorps myelin protein zero-like 2, anticorps mpzl2b, anticorps MPZL2, anticorps Mpzl2
- Sujet
- Epithelial V-like antigen (EVA) is expressed in thymus epithelium and strongly downregulated by thymocyte developmental progression. This gene is expressed in the thymus and in several epithelial structures early in embryogenesis.
- Poids moléculaire
- 22 kDa (MW of target protein)
-