Claudin 5 anticorps

N° du produit ABIN634710

Détail du produit anti-Claudin 5 anticorps

Antigène: Claudin 5 (CLDN5)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Claudin 5 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Claudin 5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Claudin 5 Blocking Peptide, catalog no. 33R-3663, is also available for use as a blocking control in assays to test for specificity of this Claudin 5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Claudin 5

Antigène: Claudin 5 (CLDN5)

Autre désignation: Claudin 5 (CLDN5 Produits)

Synonymes: anticorps AWAL, anticorps BEC1, anticorps CPETRL1, anticorps TMVCF, anticorps cld5, anticorps awal, anticorps bec1, anticorps claudin-5, anticorps cpetrl1, anticorps tmvcf, anticorps AI854493, anticorps MBEC1, anticorps Tmvcf, anticorps cldn5, anticorps zgc:85723, anticorps zgc:103419, anticorps claudin 5, anticorps Claudin-5, anticorps claudin 5 (transmembrane protein deleted in velocardiofacial syndrome), anticorps claudin 5a, anticorps claudin 5b, anticorps claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) L homeolog, anticorps CLDN5, anticorps cld5, anticorps cldn5, anticorps Cldn5, anticorps cldn5a, anticorps cldn5b, anticorps cldn5.L

Sujet: CLDN5 is a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome.

Poids moléculaire: 23 kDa (MW of target protein)

Pathways: Hepatitis C