SIGLEC7 anticorps (Middle Region)
-
- Antigène Voir toutes SIGLEC7 Anticorps
- SIGLEC7 (Sialic Acid Binding Ig-Like Lectin 7 (SIGLEC7))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SIGLEC7 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SIGLEC7 antibody was raised against the middle region of SIGLEC7
- Purification
- Affinity purified
- Immunogène
- SIGLEC7 antibody was raised using the middle region of SIGLEC7 corresponding to a region with amino acids WTWRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSL
- Top Product
- Discover our top product SIGLEC7 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SIGLEC7 Blocking Peptide, catalog no. 33R-10031, is also available for use as a blocking control in assays to test for specificity of this SIGLEC7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGLEC7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SIGLEC7 (Sialic Acid Binding Ig-Like Lectin 7 (SIGLEC7))
- Autre désignation
- SIGLEC7 (SIGLEC7 Produits)
- Synonymes
- anticorps SIGLEC7, anticorps AIRM1, anticorps CD328, anticorps CDw328, anticorps D-siglec, anticorps QA79, anticorps SIGLEC-7, anticorps SIGLEC19P, anticorps SIGLECP2, anticorps p75, anticorps p75/AIRM1, anticorps sialic acid-binding Ig-like lectin 7, anticorps sialic acid binding Ig like lectin 7, anticorps LOC468976, anticorps SIGLEC7
- Sujet
- SIGLEC7 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. In the immune response, it may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules.
- Poids moléculaire
- 51 kDa (MW of target protein)
-