SIGLEC7 anticorps (Middle Region)

N° du produit ABIN634715

Détail du produit anti-SIGLEC7 anticorps

Antigène: SIGLEC7 (Sialic Acid Binding Ig-Like Lectin 7 (SIGLEC7))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SIGLEC7 est non-conjugé

Application: Western Blotting (WB)

Specificité: SIGLEC7 antibody was raised against the middle region of SIGLEC7

Purification: Affinity purified

Immunogène: SIGLEC7 antibody was raised using the middle region of SIGLEC7 corresponding to a region with amino acids WTWRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SIGLEC7 Blocking Peptide, catalog no. 33R-10031, is also available for use as a blocking control in assays to test for specificity of this SIGLEC7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGLEC7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SIGLEC7

Antigène: SIGLEC7 (Sialic Acid Binding Ig-Like Lectin 7 (SIGLEC7))

Autre désignation: SIGLEC7 (SIGLEC7 Produits)

Synonymes: anticorps SIGLEC7, anticorps AIRM1, anticorps CD328, anticorps CDw328, anticorps D-siglec, anticorps QA79, anticorps SIGLEC-7, anticorps SIGLEC19P, anticorps SIGLECP2, anticorps p75, anticorps p75/AIRM1, anticorps sialic acid-binding Ig-like lectin 7, anticorps sialic acid binding Ig like lectin 7, anticorps LOC468976, anticorps SIGLEC7

Sujet: SIGLEC7 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. In the immune response, it may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules.

Poids moléculaire: 51 kDa (MW of target protein)