Claudin 11 anticorps
-
- Antigène Voir toutes Claudin 11 (CLDN11) Anticorps
- Claudin 11 (CLDN11)
-
Reactivité
- Humain, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Claudin 11 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogène
- Claudin 11 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH
- Top Product
- Discover our top product CLDN11 Anticorps primaire
-
anti-Claudin 11 (CLDN11) (C-Term) antibody
CLDN11 Reactivité: Humain, Souris, Rat, Boeuf (Vache) WB, ELISA, IHC, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-Claudin 11 (CLDN11) (AA 188-207) antibodyCLDN11 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Porc WB, IHC, ICC Hôte: Lapin Polyclonal unconjugated
anti-Claudin 11 (CLDN11) antibodyCLDN11 Reactivité: Humain ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Claudin 11 (CLDN11) (AA 101-218) antibodyCLDN11 Reactivité: Souris, Rat, Boeuf (Vache), Mouton WB, ELISA, IF (cc), IF (p), IHC (p), IHC (fro) Hôte: Lapin Polyclonal unconjugated
anti-Claudin 11 (CLDN11) (AA 26-207) antibodyCLDN11 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-Claudin 11 (CLDN11) (C-Term) antibodyCLDN11 Reactivité: Humain, Rat, Boeuf (Vache), Chien, Lapin, Cobaye, Cheval, Porc, Singe, Roussette (Chauve-souris) WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Claudin 11 (CLDN11) (AA 23-82) antibodyCLDN11 Reactivité: Humain ELISA, IF Hôte: Lapin Polyclonal unconjugated
anti-Claudin 11 (CLDN11) antibodyCLDN11 Reactivité: Humain IF Hôte: Lapin Polyclonal unconjugated
anti-Claudin 11 (CLDN11) (AA 1-100) antibodyCLDN11 Reactivité: Humain WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Claudin 11 (CLDN11) (AA 158-207) antibodyCLDN11 Reactivité: Humain, Souris, Rat WB, ELISA Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Claudin 11 Blocking Peptide, catalog no. 33R-9803, is also available for use as a blocking control in assays to test for specificity of this Claudin 11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Claudin 11 (CLDN11)
- Autre désignation
- Claudin 11 (CLDN11 Produits)
- Synonymes
- anticorps cldn11, anticorps fb97c11, anticorps wu:fb97c11, anticorps claudin-11, anticorps CLDN11, anticorps Claudin-11, anticorps DKFZp459H2322, anticorps OSP, anticorps OTM, anticorps Claudin11, anticorps Osp, anticorps Otm, anticorps claudin 11b, anticorps claudin 11, anticorps cldn11b, anticorps CLDN11, anticorps Cldn11
- Sujet
- CLDN11 belongs to the claudin family of tight junction associated proteins and is a major component of central nervous system myelin that is necessary for normal CNS function. There is growing evidence that the protein determines the permeability between layers of myelin sheaths via focal adhesion and, with its expression highly regulated during development, may play an important role in cellular proliferation and migration. In addition, the protein is a candidate autoantigen in the development of autoimmune demyelinating disease.
- Poids moléculaire
- 22 kDa (MW of target protein)
- Pathways
- Hepatitis C
-
