CNTNAP3 anticorps (Middle Region)

N° du produit ABIN634718

L’anticorps Lapin Polyclonal anti-CNTNAP3 a été validé pour WB. Il convient pour détecter CNTNAP3 dans des échantillons de Humain.

Aperçu rapide pour CNTNAP3 anticorps (Middle Region) (ABIN634718)

Antigène: CNTNAP3 (Contactin Associated Protein-Like 3 (CNTNAP3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CNTNAP3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CNTNAP3 anticorps

Épitope: Middle Region

Specificité: CNTNAP3 antibody was raised against the middle region of CNTNAP3

Purification: Affinity purified

Immunogène: CNTNAP3 antibody was raised using the middle region of CNTNAP3 corresponding to a region with amino acids GSGPLGPFLVYCNMTADAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CNTNAP3 Blocking Peptide, (ABIN938949), is also available for use as a blocking control in assays to test for specificity of this CNTNAP3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNTNAP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CNTNAP3

Antigène: CNTNAP3 (Contactin Associated Protein-Like 3 (CNTNAP3))

Autre désignation: CNTNAP3

Sujet: The protein encoded by this gene belongs to the NCP family of cell-recognition molecules. This family represents a distinct subgroup of the neurexins. NCP proteins mediate neuron-glial interactions in vertebrates and glial-glial contact in invertebrates.

Poids moléculaire: 141 kDa (MW of target protein)