PCDHGB1 anticorps (N-Term)

N° du produit ABIN634720

Cet anticorps Lapin Polyclonal détecte spécifiquement PCDHGB1 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour PCDHGB1 anticorps (N-Term) (ABIN634720)

Antigène: PCDHGB1 (Protocadherin gamma Subfamily B, 1 (PCDHGB1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCDHGB1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PCDHGB1 anticorps

Épitope: N-Term

Specificité: PCDHGB1 antibody was raised against the N terminal of PCDHGB1

Purification: Affinity purified

Immunogène: PCDHGB1 antibody was raised using the N terminal of PCDHGB1 corresponding to a region with amino acids SPDGSKYPVLLLEKPLDREHQSSHRLILTAMDGGDPPLSGTTHIWIRVTD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCDHGB1 Blocking Peptide, (ABIN5615252), is also available for use as a blocking control in assays to test for specificity of this PCDHGB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHGB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCDHGB1

Antigène: PCDHGB1 (Protocadherin gamma Subfamily B, 1 (PCDHGB1))

Autre désignation: PCDHGB1

Sujet: PCDHGB1 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHGB1 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Poids moléculaire: 85 kDa (MW of target protein)