SIGLEC10 anticorps (Middle Region)

N° du produit ABIN634727

L’anticorps anti-SIGLEC10 Polyclonal Lapin est utilisé pour la détection de SIGLEC10 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour SIGLEC10 anticorps (Middle Region) (ABIN634727)

Antigène: SIGLEC10 (Sialic Acid Binding Ig-Like Lectin 10 (SIGLEC10))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SIGLEC10 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SIGLEC10 anticorps

Épitope: Middle Region

Specificité: SIGLEC10 antibody was raised against the middle region of SIGLEC10

Purification: Affinity purified

Immunogène: SIGLEC10 antibody was raised using the middle region of SIGLEC10 corresponding to a region with amino acids CHVDFSRKGVSAQRTVRLRVAYAPRDLVISISRDNTPALEPQPQGNVPYL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SIGLEC10 Blocking Peptide, (ABIN937100), is also available for use as a blocking control in assays to test for specificity of this SIGLEC10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGLEC10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SIGLEC10

Antigène: SIGLEC10 (Sialic Acid Binding Ig-Like Lectin 10 (SIGLEC10))

Autre désignation: SIGLEC10

Sujet: SIGLEC10 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. SIGLEC10 preferentially binds to alpha-2,3- or alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, SIGLEC10 may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules.

Poids moléculaire: 76 kDa (MW of target protein)