CNTNAP1 anticorps (N-Term)

N° du produit ABIN634731

Cet anticorps anti-CNTNAP1 est un anticorps Lapin Polyclonal détectant CNTNAP1 dans WB. Adapté pour Humain.

Aperçu rapide pour CNTNAP1 anticorps (N-Term) (ABIN634731)

Antigène: CNTNAP1 (Contactin Associated Protein 1 (CNTNAP1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CNTNAP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CNTNAP1 anticorps

Épitope: N-Term

Specificité: CNTNAP1 antibody was raised against the N terminal of CNTNAP1

Purification: Affinity purified

Immunogène: CNTNAP1 antibody was raised using the N terminal of CNTNAP1 corresponding to a region with amino acids LQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CNTNAP1 Blocking Peptide, (ABIN5612943), is also available for use as a blocking control in assays to test for specificity of this CNTNAP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNTNAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CNTNAP1

Antigène: CNTNAP1 (Contactin Associated Protein 1 (CNTNAP1))

Autre désignation: CNTNAP1

Sujet: CNTNAP1 was initially identified as a 190 kDa protein associated with the contactin-PTPRZ1 complex. The 1,384-amino acid protein, also designated p190 or CASPR for 'contactin-associated protein,' includes an extracellular domain with several putative protein-protein interaction domains, a putative transmembrane domain, and a 74-amino acid cytoplasmic domain.

Poids moléculaire: 156 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization