CNTNAP1 anticorps (N-Term)

N° du produit ABIN634731

Détail du produit anti-CNTNAP1 anticorps

Antigène: CNTNAP1 (Contactin Associated Protein 1 (CNTNAP1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CNTNAP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CNTNAP1 antibody was raised against the N terminal of CNTNAP1

Purification: Affinity purified

Immunogène: CNTNAP1 antibody was raised using the N terminal of CNTNAP1 corresponding to a region with amino acids LQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CNTNAP1 Blocking Peptide, catalog no. 33R-5315, is also available for use as a blocking control in assays to test for specificity of this CNTNAP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNTNAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CNTNAP1

Antigène: CNTNAP1 (Contactin Associated Protein 1 (CNTNAP1))

Autre désignation: CNTNAP1 (CNTNAP1 Produits)

Synonymes: anticorps CNTNAP1, anticorps CASPR, anticorps CNTNAP, anticorps NRXN4, anticorps P190, anticorps Caspr, anticorps AI841080, anticorps NCP1, anticorps Nrxn4, anticorps p190, anticorps shm, anticorps contactin associated protein 1, anticorps contactin associated protein-like 1, anticorps CNTNAP1, anticorps cntnap1, anticorps Cntnap1

Sujet: CNTNAP1 was initially identified as a 190 kDa protein associated with the contactin-PTPRZ1 complex. The 1,384-amino acid protein, also designated p190 or CASPR for 'contactin-associated protein,' includes an extracellular domain with several putative protein-protein interaction domains, a putative transmembrane domain, and a 74-amino acid cytoplasmic domain.

Poids moléculaire: 156 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization