PCDHA12 anticorps (N-Term)

N° du produit ABIN634732

Cet anticorps Lapin Polyclonal détecte spécifiquement PCDHA12 dans WB. Il présente une réactivité envers Humain et Rat.

Aperçu rapide pour PCDHA12 anticorps (N-Term) (ABIN634732)

Antigène: PCDHA12 (Protocadherin alpha 12 (PCDHA12))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCDHA12 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PCDHA12 anticorps

Épitope: N-Term

Specificité: PCDHA12 antibody was raised against the N terminal of PCDHA12

Purification: Affinity purified

Immunogène: PCDHA12 antibody was raised using the N terminal of PCDHA12 corresponding to a region with amino acids EVIVDRPLQVFHVDVEVKDINDNPPVFREREQKVPVSESAPLDSHFPLEG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCDHA12 Blocking Peptide, (ABIN938177), is also available for use as a blocking control in assays to test for specificity of this PCDHA12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCDHA12

Antigène: PCDHA12 (Protocadherin alpha 12 (PCDHA12))

Autre désignation: PCDHA12

Sujet: PCDHA12 is a potential calcium-dependent cell-adhesion protein. PCDHA12 may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Poids moléculaire: 99 kDa (MW of target protein)