PCDHA12 anticorps (N-Term)
-
- Antigène Voir toutes PCDHA12 Anticorps
- PCDHA12 (Protocadherin alpha 12 (PCDHA12))
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PCDHA12 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PCDHA12 antibody was raised against the N terminal of PCDHA12
- Purification
- Affinity purified
- Immunogène
- PCDHA12 antibody was raised using the N terminal of PCDHA12 corresponding to a region with amino acids EVIVDRPLQVFHVDVEVKDINDNPPVFREREQKVPVSESAPLDSHFPLEG
- Top Product
- Discover our top product PCDHA12 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PCDHA12 Blocking Peptide, catalog no. 33R-2791, is also available for use as a blocking control in assays to test for specificity of this PCDHA12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PCDHA12 (Protocadherin alpha 12 (PCDHA12))
- Autre désignation
- PCDHA12 (PCDHA12 Produits)
- Synonymes
- anticorps PCDH-ALPHA12, anticorps Pcdha11, anticorps rCNRv12, anticorps Cnr5, anticorps Crnr5, anticorps Pcdha13, anticorps CNRv12, anticorps PCDHA12, anticorps protocadherin alpha 12, anticorps protocadherin alpha-12, anticorps PCDHA12, anticorps Pcdha12, anticorps LOC102147933
- Sujet
- PCDHA12 is a potential calcium-dependent cell-adhesion protein. PCDHA12 may be involved in the establishment and maintenance of specific neuronal connections in the brain.
- Poids moléculaire
- 99 kDa (MW of target protein)
-