PCDHA4 anticorps (N-Term)

N° du produit ABIN634733

L’anticorps Lapin Polyclonal anti-PCDHA4 a été validé pour WB. Il convient pour détecter PCDHA4 dans des échantillons de Humain et Rat.

Aperçu rapide pour PCDHA4 anticorps (N-Term) (ABIN634733)

Antigène: PCDHA4 (Protocadherin alpha 4 (PCDHA4))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCDHA4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PCDHA4 anticorps

Épitope: N-Term

Specificité: PCDHA4 antibody was raised against the N terminal of PCDHA4

Purification: Affinity purified

Immunogène: PCDHA4 antibody was raised using the N terminal of PCDHA4 corresponding to a region with amino acids VDRPLQVFHVDVEVRDINDNPPVFPATQKNLSIAESRPLDSRFPLEGASD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCDHA4 Blocking Peptide, (ABIN5615246), is also available for use as a blocking control in assays to test for specificity of this PCDHA4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCDHA4

Antigène: PCDHA4 (Protocadherin alpha 4 (PCDHA4))

Autre désignation: PCDHA4

Sujet: The gene encoding PCDHA4 is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences.

Poids moléculaire: 99 kDa (MW of target protein)