PCDHA4 anticorps (N-Term)
-
- Antigène Voir toutes PCDHA4 Anticorps
- PCDHA4 (Protocadherin alpha 4 (PCDHA4))
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PCDHA4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PCDHA4 antibody was raised against the N terminal of PCDHA4
- Purification
- Affinity purified
- Immunogène
- PCDHA4 antibody was raised using the N terminal of PCDHA4 corresponding to a region with amino acids VDRPLQVFHVDVEVRDINDNPPVFPATQKNLSIAESRPLDSRFPLEGASD
- Top Product
- Discover our top product PCDHA4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PCDHA4 Blocking Peptide, catalog no. 33R-9478, is also available for use as a blocking control in assays to test for specificity of this PCDHA4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PCDHA4 (Protocadherin alpha 4 (PCDHA4))
- Autre désignation
- PCDHA4 (PCDHA4 Produits)
- Synonymes
- anticorps CNR1, anticorps CNRN1, anticorps CRNR1, anticorps PCDH-ALPHA4, anticorps Cnr1, anticorps Crnr1, anticorps R75250, anticorps PCDHA4, anticorps CNRv4, anticorps Pcdha4, anticorps protocadherin alpha 4, anticorps protocadherin alpha-4, anticorps PCDHA4, anticorps Pcdha4, anticorps LOC100713594, anticorps LOC100629843
- Sujet
- The gene encoding PCDHA4 is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences.
- Poids moléculaire
- 99 kDa (MW of target protein)
-