Neuroligin 4 anticorps (N-Term)

N° du produit ABIN634735

Cet anticorps Lapin Polyclonal détecte spécifiquement Neuroligin 4 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour Neuroligin 4 anticorps (N-Term) (ABIN634735)

Antigène: Neuroligin 4 (NLGN4)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Neuroligin 4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Neuroligin 4 anticorps

Épitope: N-Term

Specificité: NLGN4 X antibody was raised against the N terminal of NLGN4

Purification: Affinity purified

Immunogène: NLGN4 X antibody was raised using the N terminal of NLGN4 corresponding to a region with amino acids SILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEEN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NLGN4X Blocking Peptide, (ABIN5615006), is also available for use as a blocking control in assays to test for specificity of this NLGN4X antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NLGN0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Neuroligin 4

Antigène: Neuroligin 4 (NLGN4)

Autre désignation: NLGN4X

Sujet: NLGN4X is a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. It interacts with discs, large (Drosophila) homolog 4 (DLG4). NLGN4X might play a role in the autism and Asperger syndrome.

Poids moléculaire: 92 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Synaptic Membrane