PCDHA10 anticorps (N-Term)
-
- Antigène Voir toutes PCDHA10 Anticorps
- PCDHA10 (Protocadherin alpha 10 (PCDHA10))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PCDHA10 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PCDHA10 antibody was raised against the N terminal of PCDHA10
- Purification
- Affinity purified
- Immunogène
- PCDHA10 antibody was raised using the N terminal of PCDHA10 corresponding to a region with amino acids DKDKFPVLVLRKLLDREENPQLKLLLTATDGGKPEFTGSVSLLILVLDAN
- Top Product
- Discover our top product PCDHA10 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PCDHA10 Blocking Peptide, catalog no. 33R-2014, is also available for use as a blocking control in assays to test for specificity of this PCDHA10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PCDHA10 (Protocadherin alpha 10 (PCDHA10))
- Autre désignation
- PCDHA10 (PCDHA10 Produits)
- Synonymes
- anticorps CNR8, anticorps CNRN8, anticorps CNRS8, anticorps CRNR8, anticorps PCDH-ALPHA10, anticorps Cnr3, anticorps Cnr8, anticorps Crnr3, anticorps Crnr8, anticorps Pcdha14, anticorps rCNRv10, anticorps protocadherin alpha 10, anticorps PCDHA10, anticorps Pcdha10
- Sujet
- This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster.
- Poids moléculaire
- 73 kDa (MW of target protein)
-