ITGB8 anticorps (C-Term)

N° du produit ABIN634750

Détail du produit anti-ITGB8 anticorps

Antigène: ITGB8 (Integrin beta-8 (ITGB8))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ITGB8 est non-conjugé

Application: Western Blotting (WB)

Specificité: Integrin Beta 8 antibody was raised against the C terminal of ITGB8

Purification: Affinity purified

Immunogène: Integrin Beta 8 antibody was raised using the C terminal of ITGB8 corresponding to a region with amino acids CTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCAL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Integrin Beta 8 Blocking Peptide, catalog no. 33R-1821, is also available for use as a blocking control in assays to test for specificity of this Integrin Beta 8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGB8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ITGB8

Antigène: ITGB8 (Integrin beta-8 (ITGB8))

Autre désignation: Integrin beta 8 (ITGB8 Produits)

Synonymes: anticorps 4832412O06Rik, anticorps integrin beta 8, anticorps integrin subunit beta 8, anticorps Itgb8, anticorps ITGB8

Sujet: ITGB8 is a member of the integrin beta chain family and is a single-pass type I membrane protein with a VWFA domain and four cysteine-rich repeats. This protein noncovalently binds to an alpha subunit to form a heterodimeric integrin complex. In general, integrin complexes mediate cell-cell and cell-extracellular matrix interactions and this complex plays a role in human airway epithelial proliferation.

Poids moléculaire: 81 kDa (MW of target protein)