SIGLEC9 anticorps (C-Term)

N° du produit ABIN634755

Cet anticorps anti-SIGLEC9 est un anticorps Lapin Polyclonal détectant SIGLEC9 dans WB. Adapté pour Humain.

Aperçu rapide pour SIGLEC9 anticorps (C-Term) (ABIN634755)

Antigène: SIGLEC9 (Sialic Acid Binding Ig-Like Lectin 9 (SIGLEC9))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SIGLEC9 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SIGLEC9 anticorps

Épitope: C-Term

Specificité: SIGLEC9 antibody was raised against the C terminal of SIGLEC9

Purification: Affinity purified

Immunogène: SIGLEC9 antibody was raised using the C terminal of SIGLEC9 corresponding to a region with amino acids PWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQGVVGGAGATA

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SIGLEC9 Blocking Peptide, (ABIN5616146), is also available for use as a blocking control in assays to test for specificity of this SIGLEC9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGLEC9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SIGLEC9

Antigène: SIGLEC9 (Sialic Acid Binding Ig-Like Lectin 9 (SIGLEC9))

Autre désignation: SIGLEC9

Sujet: SIGLEC9 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. It preferentially binds to alpha2,3- or 2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.

Poids moléculaire: 50 kDa (MW of target protein)