CD5 anticorps (N-Term)

N° du produit ABIN634761

Cet anticorps anti-CD5 est un anticorps Lapin Polyclonal détectant CD5 dans WB. Adapté pour Humain.

Aperçu rapide pour CD5 anticorps (N-Term) (ABIN634761)

Antigène: CD5

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CD5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CD5 anticorps

Épitope: N-Term

Specificité: CD5 antibody was raised against the N terminal of CD5

Purification: Affinity purified

Immunogène: CD5 antibody was raised using the N terminal of CD5 corresponding to a region with amino acids MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CD5 Blocking Peptide, (ABIN5612760), is also available for use as a blocking control in assays to test for specificity of this CD5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CD5

Antigène: CD5

Autre désignation: CD5

Sujet: CD5 may act as a receptor in regulating T-cell proliferation. CD5 interacts with CD72/LYB-2.

Poids moléculaire: 54 kDa (MW of target protein)