GMFG anticorps (Middle Region)

N° du produit ABIN634779

Cet anticorps anti-GMFG est un anticorps Lapin Polyclonal détectant GMFG dans WB. Adapté pour Humain.

Aperçu rapide pour GMFG anticorps (Middle Region) (ABIN634779)

Antigène: GMFG (Glia Maturation Factor, gamma (GMFG))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GMFG est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GMFG anticorps

Épitope: Middle Region

Specificité: GMF gamma antibody was raised against the middle region of GMFG

Purification: Affinity purified

Immunogène: GMF gamma antibody was raised using the middle region of GMFG corresponding to a region with amino acids KVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GMF gamma Blocking Peptide, (ABIN940087), is also available for use as a blocking control in assays to test for specificity of this GMF gamma antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GMFG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GMFG

Antigène: GMFG (Glia Maturation Factor, gamma (GMFG))

Autre désignation: GMF gamma

Sujet: The function of GMF gamma protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 17 kDa (MW of target protein)