TFF1 anticorps (Middle Region)
-
- Antigène Voir toutes TFF1 Anticorps
- TFF1 (Trefoil Factor 1 (TFF1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TFF1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TFF1 antibody was raised against the middle region of TFF1
- Purification
- Affinity purified
- Immunogène
- TFF1 antibody was raised using the middle region of TFF1 corresponding to a region with amino acids PRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
- Top Product
- Discover our top product TFF1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TFF1 Blocking Peptide, catalog no. 33R-7321, is also available for use as a blocking control in assays to test for specificity of this TFF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TFF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TFF1 (Trefoil Factor 1 (TFF1))
- Autre désignation
- TFF1 (TFF1 Produits)
- Synonymes
- anticorps BCEI, anticorps D21S21, anticorps HP1.A, anticorps HPS2, anticorps pNR-2, anticorps pS2, anticorps Bcei, anticorps PS2, anticorps bcei, anticorps d21s21, anticorps hp1.a, anticorps hps2, anticorps p1, anticorps p1-a, anticorps pnr-2, anticorps ps2, anticorps tff1, anticorps xP1, anticorps xp1-L, anticorps xp1, anticorps TFF1, anticorps Ps2, anticorps trefoil factor 1, anticorps trefoil factor 1 S homeolog, anticorps trefoil factor 1, gene 2 S homeolog, anticorps TFF1, anticorps Tff1, anticorps tff1.S, anticorps tff1.2.S, anticorps LOC100358238
- Sujet
- Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa.
- Poids moléculaire
- 7 kDa (MW of target protein)
- Pathways
- EGFR Signaling Pathway
-