TFF1 anticorps (Middle Region)

N° du produit ABIN634784

L’anticorps anti-TFF1 Polyclonal Lapin est utilisé pour la détection de TFF1 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour TFF1 anticorps (Middle Region) (ABIN634784)

Antigène: TFF1 (Trefoil Factor 1 (TFF1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TFF1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TFF1 anticorps

Épitope: Middle Region

Specificité: TFF1 antibody was raised against the middle region of TFF1

Purification: Affinity purified

Immunogène: TFF1 antibody was raised using the middle region of TFF1 corresponding to a region with amino acids PRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TFF1 Blocking Peptide, (ABIN5616568), is also available for use as a blocking control in assays to test for specificity of this TFF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TFF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TFF1

Antigène: TFF1 (Trefoil Factor 1 (TFF1))

Autre désignation: TFF1

Sujet: Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa.

Poids moléculaire: 7 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway