PNOC anticorps (Middle Region)

N° du produit ABIN634785

Détail du produit anti-PNOC anticorps

Antigène: PNOC (Prepronociceptin (PNOC))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PNOC est non-conjugé

Application: Western Blotting (WB)

Specificité: PNOC antibody was raised against the middle region of PNOC

Purification: Affinity purified

Immunogène: PNOC antibody was raised using the middle region of PNOC corresponding to a region with amino acids EQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PNOC Blocking Peptide, catalog no. 33R-2660, is also available for use as a blocking control in assays to test for specificity of this PNOC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNOC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PNOC

Antigène: PNOC (Prepronociceptin (PNOC))

Autre désignation: PNOC (PNOC Produits)

Synonymes: anticorps N23K, anticorps Npnc1, anticorps PPNOC, anticorps N/OFQ, anticorps OFQ/N, anticorps PNOC, anticorps OFQ, anticorps prepronociceptin, anticorps PNOC, anticorps Pnoc

Sujet: Nociceptin is the ligand of the opioid receptor-like receptor (OPRL1). It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. PNOC may be involved in neuronal differentiation and development.

Poids moléculaire: 20 kDa (MW of target protein)