LEFTY1 anticorps (N-Term)

N° du produit ABIN634795

Détail du produit anti-LEFTY1 anticorps

Antigène: LEFTY1 (Left-Right Determination Factor 1 (LEFTY1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LEFTY1 est non-conjugé

Application: Western Blotting (WB)

Specificité: LEFTY1 antibody was raised against the N terminal of LEFTY1

Purification: Affinity purified

Immunogène: LEFTY1 antibody was raised using the N terminal of LEFTY1 corresponding to a region with amino acids MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLDRADMEE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LEFTY1 Blocking Peptide, catalog no. 33R-6338, is also available for use as a blocking control in assays to test for specificity of this LEFTY1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEFTY1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LEFTY1

Antigène: LEFTY1 (Left-Right Determination Factor 1 (LEFTY1))

Autre désignation: LEFTY1 (LEFTY1 Produits)

Synonymes: anticorps atv, anticorps cb73, anticorps antivin, anticorps ik:tdsubc_2b12, anticorps xx:tdsubc_2b12, anticorps LEFTY1, anticorps AI450052, anticorps Ebaf, anticorps Leftb, anticorps Stra3, anticorps Tgfb4, anticorps lefty, anticorps lefty-1, anticorps RGD1561867, anticorps LEFTB, anticorps LEFTYB, anticorps lefty1, anticorps signaling molecule lefty1, anticorps left-right determination factor 1, anticorps left right determination factor 1, anticorps lft1, anticorps lefty1, anticorps LOC699924, anticorps LEFTY1, anticorps LOC100408003, anticorps LOC100597378, anticorps Lefty1

Sujet: LEFTY1 is a member of the TGF-beta family of proteins. A similar secreted protein in mouse plays a role in left-right asymmetry determination of organ systems during development.

Poids moléculaire: 11 kDa (MW of target protein)