AMH anticorps (Middle Region)

N° du produit ABIN634797

Cet anticorps anti-AMH est un anticorps Lapin Polyclonal détectant AMH dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour AMH anticorps (Middle Region) (ABIN634797)

Antigène: AMH (Anti-Mullerian Hormone (AMH))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AMH est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-AMH anticorps

Épitope: Middle Region

Specificité: AMH antibody was raised against the middle region of AMH

Purification: Affinity purified

Immunogène: AMH antibody was raised using the middle region of AMH corresponding to a region with amino acids SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AMH Blocking Peptide, (ABIN5612045), is also available for use as a blocking control in assays to test for specificity of this AMH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AMH

Antigène: AMH (Anti-Mullerian Hormone (AMH))

Autre désignation: AMH

Sujet: Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome.

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion