Enkephalin anticorps (Middle Region)
-
- Antigène Voir toutes Enkephalin (PENK) Anticorps
- Enkephalin (PENK) (Proenkephalin (PENK))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Enkephalin est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PENK antibody was raised against the middle region of PENK
- Purification
- Affinity purified
- Immunogène
- PENK antibody was raised using the middle region of PENK corresponding to a region with amino acids DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG
- Top Product
- Discover our top product PENK Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PENK Blocking Peptide, catalog no. 33R-1846, is also available for use as a blocking control in assays to test for specificity of this PENK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PENK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Enkephalin (PENK) (Proenkephalin (PENK))
- Autre désignation
- PENK (PENK Produits)
- Synonymes
- anticorps AI326464, anticorps ENK, anticorps PPA, anticorps Penk1, anticorps PENK, anticorps penk, anticorps Enk, anticorps Penk-rs, anticorps Penk2, anticorps penkl, anticorps zgc:73353, anticorps Penk, anticorps proenkephalin, anticorps preproenkephalin, anticorps proenkephalin b, anticorps proenkephalin L homeolog, anticorps proenkephalin a, anticorps PENK, anticorps Penk, anticorps penk, anticorps penkb, anticorps penk.L, anticorps penka
- Sujet
- Met- and Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress.
- Poids moléculaire
- 31 kDa (MW of target protein)
- Pathways
- Stem Cell Maintenance
-