Hepcidin anticorps (N-Term)

N° du produit ABIN634809

Cet anticorps anti-Hepcidin est un anticorps Lapin Polyclonal détectant Hepcidin dans WB. Adapté pour Humain. Ce Primary Antibody a été cité dans 1 publication.

Aperçu rapide pour Hepcidin anticorps (N-Term) (ABIN634809)

Antigène: Hepcidin (HAMP) (Hepcidin Antimicrobial Peptide (HAMP))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Hepcidin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Hepcidin anticorps

Épitope: N-Term

Specificité: HAMP antibody was raised against the N terminal of HAMP

Purification: Affinity purified

Immunogène: HAMP antibody was raised using the N terminal of HAMP corresponding to a region with amino acids MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HAMP Blocking Peptide, (ABIN5613923), is also available for use as a blocking control in assays to test for specificity of this HAMP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAMP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Références pour anticorps anti-Hepcidin (ABIN634809)

Blanchette-Farra, Kita, Konstorum, Tesfay, Lemler, Hegde, Claffey, Torti, Torti: "Contribution of three-dimensional architecture and tumor-associated fibroblasts to hepcidin regulation in breast cancer." dans: Oncogene, Vol. 37, Issue 29, pp. 4013-4032, (2019) (PubMed).

Détails sur Hepcidin

Antigène: Hepcidin (HAMP) (Hepcidin Antimicrobial Peptide (HAMP))

Autre désignation: HAMP

Sujet: The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption.

Poids moléculaire: 9 kDa (MW of target protein)

Pathways: Hormone Activity, Transition Metal Ion Homeostasis