PI16 anticorps (Middle Region)

N° du produit ABIN634818

Détail du produit anti-PI16 anticorps

Antigène: PI16 (Peptidase Inhibitor 16 (PI16))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PI16 est non-conjugé

Application: Western Blotting (WB)

Specificité: PI16 antibody was raised against the middle region of PI16

Purification: Affinity purified

Immunogène: PI16 antibody was raised using the middle region of PI16 corresponding to a region with amino acids SKSLPNFPNTSATANATGGRALALQSSLPGAEGPDKPSVVSGLNSGPGHV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PI16 Blocking Peptide, catalog no. 33R-8568, is also available for use as a blocking control in assays to test for specificity of this PI16 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PI16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PI16

Antigène: PI16 (Peptidase Inhibitor 16 (PI16))

Autre désignation: PI16 (PI16 Produits)

Synonymes: anticorps CRISP9, anticorps MSMBBP, anticorps PSPBP, anticorps 1200009H11Rik, anticorps Cripi, anticorps PI-16, anticorps peptidase inhibitor 16, anticorps Pi16, anticorps Tsp_02917, anticorps PI16

Sujet: PI16 is a putative serine protease inhibitor. PI16 may serve as a marker following prostatectomy for prostate cancer.

Poids moléculaire: 47 kDa (MW of target protein)