PI16 anticorps (Middle Region)
-
- Antigène Voir toutes PI16 Anticorps
- PI16 (Peptidase Inhibitor 16 (PI16))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PI16 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PI16 antibody was raised against the middle region of PI16
- Purification
- Affinity purified
- Immunogène
- PI16 antibody was raised using the middle region of PI16 corresponding to a region with amino acids SKSLPNFPNTSATANATGGRALALQSSLPGAEGPDKPSVVSGLNSGPGHV
- Top Product
- Discover our top product PI16 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PI16 Blocking Peptide, catalog no. 33R-8568, is also available for use as a blocking control in assays to test for specificity of this PI16 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PI16 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PI16 (Peptidase Inhibitor 16 (PI16))
- Autre désignation
- PI16 (PI16 Produits)
- Synonymes
- anticorps CRISP9, anticorps MSMBBP, anticorps PSPBP, anticorps 1200009H11Rik, anticorps Cripi, anticorps PI-16, anticorps peptidase inhibitor 16, anticorps Pi16, anticorps Tsp_02917, anticorps PI16
- Sujet
- PI16 is a putative serine protease inhibitor. PI16 may serve as a marker following prostatectomy for prostate cancer.
- Poids moléculaire
- 47 kDa (MW of target protein)
-