TMEM168 anticorps (C-Term)

N° du produit ABIN634819

Cet anticorps Lapin Polyclonal détecte spécifiquement TMEM168 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour TMEM168 anticorps (C-Term) (ABIN634819)

Antigène: TMEM168 (Transmembrane Protein 168 (TMEM168))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM168 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TMEM168 anticorps

Épitope: C-Term

Specificité: TMEM168 antibody was raised against the C terminal of TMEM168

Purification: Affinity purified

Immunogène: TMEM168 antibody was raised using the C terminal of TMEM168 corresponding to a region with amino acids EEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSDYTL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM168 Blocking Peptide, (ABIN937722), is also available for use as a blocking control in assays to test for specificity of this TMEM168 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM168 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM168

Antigène: TMEM168 (Transmembrane Protein 168 (TMEM168))

Autre désignation: TMEM168

Sujet: TMEM168 is a multi-pass membrane protein. It belongs to the TMEM168 family. The exact function of TMEM168 remains unknown.

Poids moléculaire: 80 kDa (MW of target protein)